PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB10G17260.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 242aa    MW: 27453 Da    PI: 7.0433
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB10G17260.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox24.35.4e-082193956
                  S-HHHHHHHHHHHHHHHH CS
      Homeobox 39 LterqVkvWFqNrRakek 56
                  +  rqV +WFqNrRa++k
  OB10G17260.1  2 IAPRQVAIWFQNRRARWK 19
                  5689*************9 PP

2HD-ZIP_I/II71.32e-232563892
   HD-ZIP_I/II 38 lqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92
                  + prqva+WFqnrRAR+ktkqlEkd++aL+r++da ++en++L + +++L++e+ 
  OB10G17260.1  2 IAPRQVAIWFQNRRARWKTKQLEKDFDALRRQLDAARSENDALLALNSKLHAEIV 56
                  68*************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.495121IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.3E-8328IPR009057Homeodomain-like
PfamPF000462.7E-5319IPR001356Homeobox domain
CDDcd000865.21E-5422No hitNo description
SuperFamilySSF466896.84E-7430IPR009057Homeodomain-like
PfamPF021833.8E-102160IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 242 aa     Download sequence    Send to blast
MIAPRQVAIW FQNRRARWKT KQLEKDFDAL RRQLDAARSE NDALLALNSK LHAEIVALKG  60
GAAAGGGGGG SSCRQEAASE LINLNVKETE ASCSNRSENS SEINLDISRT PPXXXXXXXX  120
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  180
XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXFGGL LCGAVDEQPP FWPWADGHHH  240
FH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11321RRARWKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2877001e-150AK287700.1 Oryza sativa Japonica Group cDNA, clone: J065130H05, full insert sequence.
GenBankCT8377491e-150CT837749.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCEA049M06, full insert sequence.
GenBankEU0854311e-150EU085431.1 Oryza sativa Indica Group homeodomain-leucine zipper transcription factor (hox23) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotA2Z7342e-54HOX23_ORYSI; Homeobox-leucine zipper protein HOX23
SwissprotQ94GL52e-54HOX23_ORYSJ; Homeobox-leucine zipper protein HOX23
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69780.12e-32HD-ZIP family protein